1A32_HUMAN - dbPTM
1A32_HUMAN - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 1A32_HUMAN
UniProt AC P10314
Protein Name HLA class I histocompatibility antigen, A-32 alpha chain
Gene Name HLA-A
Organism Homo sapiens (Human).
Sequence Length 365
Subcellular Localization Membrane
Single-pass type I membrane protein.
Protein Description Involved in the presentation of foreign antigens to the immune system..
Protein Sequence MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAHSQTDRESLRIALRYYNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAMFAGAVVAAVRWRRKSSDRKGGSYSQAASSDSAQGSDMSLTACKV
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
170UbiquitinlysineAAQITQRKWEAARVA
CHHHHHHHHCCHHHH
39.3021906983
21890473
188 S-glutathionyl cysteineRAYLEGTCVEWLRRY
HHHHCCCCCHHHHHC
3.7222555962
200UbiquitinlysineRRYLENGKETLQRTD
HHCCCCCCCCCCCCC
60.1421906983
21890473
267UbiquitinlysineAGDGTFQKWASVVVP
CCCCCEEEEEEEEEE
40.3021906983
21890473
292UbiquitinlysineVQHEGLPKPLTLRWE
EECCCCCCCEEEEEC
58.6721906983
21890473
340UbiquitinlysineRRKSSDRKGGSYSQA
EECCCCCCCCCCCCC
73.0321906983
21890473
343PhosphoserineSSDRKGGSYSQAASS
CCCCCCCCCCCCCCC
30.2224275569
344PhosphotyrosineSDRKGGSYSQAASSD
CCCCCCCCCCCCCCC
14.2124275569
345PhosphoserineDRKGGSYSQAASSDS
CCCCCCCCCCCCCCC
18.2924275569
349PhosphoserineGSYSQAASSDSAQGS
CCCCCCCCCCCCCCC
37.3824275569
352PhosphoserineSQAASSDSAQGSDMS
CCCCCCCCCCCCEEE
25.1724275569
356PhosphoserineSSDSAQGSDMSLTAC
CCCCCCCCEEEECCC
20.3324275569
359PhosphoserineSAQGSDMSLTACKV-
CCCCCEEEECCCCC-
27.7924275569
364UbiquitinlysineDMSLTACKV------
EEEECCCCC------
48.8121906983
21890473

Disease-associated PTM Sites based on nsSNP

* Distance = the distance between SNP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SNP Related Disease Reference
170Ubiquitination166 (4)ITrs1059516--
170Ubiquitination168 (2)QKrs1059517--
170Ubiquitination175 (5)RHrs1059536--
170Ubiquitination176 (6)VErs9256983Pneumonia: susceptibility to pneumonia measurement28928442
188Glutathionylation185 (3)EDrs1059542--

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of 1A32_HUMAN !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP