1A32_HUMAN - dbPTM
1A32_HUMAN - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 1A32_HUMAN
UniProt AC P10314
Protein Name HLA class I histocompatibility antigen, A-32 alpha chain
Gene Name HLA-A
Organism Homo sapiens (Human).
Sequence Length 365
Subcellular Localization Membrane
Single-pass type I membrane protein.
Protein Description Involved in the presentation of foreign antigens to the immune system..
Protein Sequence MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAHSQTDRESLRIALRYYNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAMFAGAVVAAVRWRRKSSDRKGGSYSQAASSDSAQGSDMSLTACKV
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
170UbiquitinlysineAAQITQRKWEAARVA
HHHHHHHHHHHHHHH
39.3021906983
21890473
188 S-glutathionyl cysteineRAYLEGTCVEWLRRY
HHHHHCHHHHHHHHH
3.7222555962
200UbiquitinlysineRRYLENGKETLQRTD
HHHHHCCHHHHHCCC
60.1421906983
21890473
267UbiquitinlysineAGDGTFQKWASVVVP
CCCCCEEEEEEEEEC
40.3021906983
21890473
292UbiquitinlysineVQHEGLPKPLTLRWE
EEECCCCCCEEEECC
58.6721906983
21890473
340UbiquitinlysineRRKSSDRKGGSYSQA
HHCCCCCCCCCCHHC
73.0321906983
21890473
343PhosphoserineSSDRKGGSYSQAASS
CCCCCCCCCHHCCCC
30.2224275569
344PhosphotyrosineSDRKGGSYSQAASSD
CCCCCCCCHHCCCCC
14.2124275569
345PhosphoserineDRKGGSYSQAASSDS
CCCCCCCHHCCCCCC
18.2924275569
349PhosphoserineGSYSQAASSDSAQGS
CCCHHCCCCCCCCCC
37.3824275569
352PhosphoserineSQAASSDSAQGSDMS
HHCCCCCCCCCCCCC
25.1724275569
356PhosphoserineSSDSAQGSDMSLTAC
CCCCCCCCCCCCEEE
20.3324275569
359PhosphoserineSAQGSDMSLTACKV-
CCCCCCCCCEEECC-
27.7924275569
364UbiquitinlysineDMSLTACKV------
CCCCEEECC------
48.8121906983
21890473

Disease-associated PTM Sites based on nsSNP

* Distance = the distance between SNP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SNP Related Disease Reference

Oops, there are no SNP-PTM records of 1A32_HUMAN !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of 1A32_HUMAN !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP