1A03_HUMAN - dbPTM
1A03_HUMAN - PTM Information in dbPTM
Basic Information of Protein
UniProt ID 1A03_HUMAN
UniProt AC P04439
Protein Name HLA class I histocompatibility antigen, A-3 alpha chain
Gene Name HLA-A
Organism Homo sapiens (Human).
Sequence Length 365
Subcellular Localization Membrane
Single-pass type I membrane protein.
Protein Description Involved in the presentation of foreign antigens to the immune system..
Protein Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
92UbiquitinlysineDQETRNVKAQSQTDR
CHHHCCHHCCCCCCC
44.2321890473
21906983
145UbiquitinlysineRQDAYDGKDYIALNE
CCCCCCCCCEEEECH
44.4521890473
21906983
168UbiquitinlysineDMAAQITKRKWEAAH
HHHHHHHHHHHHHHH
54.3221890473
21906983
200UbiquitinlysineRRYLENGKETLQRTD
HHHHHHCHHHHHCCC
60.1421890473
21906983
267UbiquitinlysineAGDGTFQKWAAVVVP
CCCCCEECEEEEEEC
34.3121890473
21906983
292UbiquitinlysineVQHEGLPKPLTLRWE
EEECCCCCCEEEEEE
58.6721890473
21906983
336PhosphoserineAVMWRRKSSDRKGGS
HHHHHCCCCCCCCCC
35.346333425
337PhosphoserineVMWRRKSSDRKGGSY
HHHHCCCCCCCCCCC
44.466333425
340UbiquitinlysineRRKSSDRKGGSYTQA
HCCCCCCCCCCCEEE
73.0321890473
21906983
343PhosphoserineSSDRKGGSYTQAASS
CCCCCCCCCEEECCC
33.406333425
344PhosphotyrosineSDRKGGSYTQAASSD
CCCCCCCCEEECCCC
13.226304688
352PhosphoserineTQAASSDSAQGSDVS
EEECCCCCCCCCCCE
25.1724275569
356PhosphoserineSSDSAQGSDVSLTAC
CCCCCCCCCCEEEEE
23.8224275569
359PhosphoserineSAQGSDVSLTACKV-
CCCCCCCEEEEECC-
25.6224275569
364UbiquitinlysineDVSLTACKV------
CCEEEEECC------
48.8121890473
21906983
771N-linked Glycosylation-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19349973
774N-linked Glycosylation--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19349973

Disease-associated PTM Sites based on nsSNP

* Distance = the distance between SNP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SNP Related Disease Reference
168Ubiquitination176 (8)EA;G;Vrs9256983
  • Pneumonia:susceptibility to pneumonia measurement
28928442

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
UGGG1_HUMANUGGT1physical
17353931
CD8A_HUMANCD8Aphysical
9177355
CD8A_HUMANCD8Aphysical
10809759
COPB_HUMANCOPB1physical
11884415
COPG1_HUMANCOPG1physical
11884415
TPSN_HUMANTAPBPphysical
11884415
TAP1_HUMANTAP1physical
11884415
SYVN1_HUMANSYVN1physical
21245296
UB2J1_HUMANUBE2J1physical
21245296
DERL1_HUMANDERL1physical
21245296
PSMD2_HUMANPSMD2physical
21245296
MAGA4_HUMANMAGEA4physical
21815906
BAP31_HUMANBCAP31physical
17056546
B2MG_HUMANB2Mphysical
8805302
STAT3_HUMANSTAT3physical
21988832
GNAS3_HUMANGNASphysical
9914489
GNAS2_HUMANGNASphysical
9914489
ALEX_HUMANGNASphysical
9914489
GNAS1_HUMANGNASphysical
9914489
BAG6_HUMANBAG6physical
21636303
MEOX2_HUMANMEOX2physical
24722188

Drug and Disease Associations
Kegg Disease
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Related Literatures of Post-Translational Modification

TOP